DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and AKR1B15

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001074007.2 Gene:AKR1B15 / 441282 HGNCID:37281 Length:344 Species:Homo sapiens


Alignment Length:349 Identity:131/349 - (37%)
Similarity:191/349 - (54%) Gaps:39/349 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLAPTVKLNNGYEM--------PILGLGTYNSKDNEG----------------EAAVKHAIDVG 41
            :::.|.|...|.:..        |:.||.:...||...                :.|||.|||..
Human     3 LQMEPQVNSTNNFHQGPLDQPVGPLTGLKSSLLKDTTSAGPLLRPYPASLLGKVKEAVKVAIDAE 67

  Fly    42 YRHIDTAYFYQNEAEVGKAIRDKIAEGVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDY 106
            |||||.||||:|:.|||:||::||.|..|.|||:|:|:|:|..|.:...|.....|.|.:..|.|
Human    68 YRHIDCAYFYENQHEVGEAIQEKIQEKAVMREDLFIVSKVWPTFFERPLVRKAFEKTLKDLKLSY 132

  Fly   107 IDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQL 171
            :|:||:|.|.|:|..||  ..||::...:......:||.::|||:||..|||:::||||||..|:
Human   133 LDVYLIHWPQGFKTGDD--FFPKDDKGNMISGKGTFLDAWEAMEELVDEGLVKALGVSNFNHFQI 195

  Fly   172 ARVL--ANCEIKPVTNQVECSPALNQKALTAFCKKNDVTLTGYTPLGKP-----KPDIQKPDFIY 229
            .|:|  ...:.|||||||||.|.|.|:.|..:|....:|:|.|:|||.|     ||  :.|..:.
Human   196 ERLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKP--EDPSLLE 258

  Fly   230 SPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTG 294
            .|::..||.|:.|||.|:::|:.:...|..||||.....|.||..:|||:|:.||||.:..::..
Human   259 DPKIKEIAAKHKKTTAQVLIRFHIQRNVTVIPKSMTPAHIVENIQVFDFKLSDEEMATILSFNRN 323

  Fly   295 ERVVPLNLIKGLNH-KYYPFSIEF 317
            .|...   .|..:| :.:||..|:
Human   324 WRAFD---FKEFSHLEDFPFDAEY 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 126/327 (39%)
Tas 5..297 CDD:223739 125/322 (39%)
AKR1B15NP_001074007.2 ARA1 56..325 CDD:223729 117/272 (43%)
Tas 57..317 CDD:223739 117/263 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158435
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.