DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and CG12224

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_650139.3 Gene:CG12224 / 41453 FlyBaseID:FBgn0037974 Length:338 Species:Drosophila melanogaster


Alignment Length:321 Identity:81/321 - (25%)
Similarity:122/321 - (38%) Gaps:83/321 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKREDIFLVTKLWNIFHDPERV-- 91
            ||...|:.||..|..:||||.|. :|..:|:|::|      |.||..::.||:.....||:.:  
  Fly    56 EGILMVQEAIRSGINYIDTAPFL-SEVLLGQALKD------VPREAYYIATKVARYGLDPKNMFD 113

  Fly    92 -------EGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLSDVDYLDTYKAM 149
                   |.: ::.|....||.:|:..:|         |....| |.|.||.       :|...:
  Fly   114 YSADKARESV-KRSLERLQLDRVDILQVH---------DVDAAP-NLDIVLN-------ETIPVL 160

  Fly   150 EKLVKLGLVRSIGVSNFNSEQLARVLANC------EIKPVTNQVECSPALNQKALTAFCKKND-- 206
            |:.|:.|..|.|||:.::.:    ||..|      .|:.|.|....:  |....|..:.|...  
  Fly   161 EEYVQAGKARFIGVTAYDVD----VLKECAERGKGRIQVVLNYARYT--LLDNTLLRYMKDFQKM 219

  Fly   207 ---VTLTGYTPLG---KPKPDIQKPDFIYSPEVAVIAKKYGKTTPQ-------IVLRYLVGLG-- 256
               |.......||   ...|....|.   |.|:..:||:..:...|       :.:.|.:.|.  
  Fly   220 GVGVVCAAAHSLGLLRNAGPHASHPG---SQEILAVAKRGAEICQQRNVELGKLAMYYTMQLDGA 281

  Fly   257 ---VIPIPKSSNTNRISENFD-IFDFELTAEEMAVLD---------GYHTGERVVPLNLIK 304
               :|.||   |...:..|.| ||| .||:.|..||.         .|..|..:....|:|
  Fly   282 ATFLIGIP---NRKLLRINLDAIFD-GLTSHEQEVLQYLRENVFTKSYSWGSTLSTAKLLK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 79/317 (25%)
Tas 5..297 CDD:223739 79/312 (25%)
CG12224NP_650139.3 AKR_galDH 22..311 CDD:381389 75/292 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.