DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and CG6083

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_648485.1 Gene:CG6083 / 39305 FlyBaseID:FBgn0036183 Length:322 Species:Drosophila melanogaster


Alignment Length:314 Identity:130/314 - (41%)
Similarity:191/314 - (60%) Gaps:8/314 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGV 69
            |...|:||..||:|||||:.|.......|||.|||:||||.|.|:.|.|||:||.|:|:|:.|||
  Fly     4 PNFLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGV 68

  Fly    70 VKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNED-D 133
            |.|:::|:.:||||..|.|:.|...|...:.|.|:.|::|||||.|:.||...|| |.|...| :
  Fly    69 VTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDN-LYPTCPDTN 132

  Fly   134 VLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQKAL 198
            .....|:||:||::|||.||..||.::|||||||.:|:.|:|:..::|||..|:||.|.|:||.|
  Fly   133 KAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLSQKPL 197

  Fly   199 TAFCKKNDVTLTGYTPLGKPKPDIQKP---DFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPI 260
            ...|..|.:.:|.|:.||......:||   ..:..|.:..||:||.:|..|::||:....|:|.|
  Fly   198 ITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYERTAAQVLLRFQTQSGIIVI 262

  Fly   261 PKSSNTNRISENFD-IFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPF 313
            |:|.:...:.:||. |:||||..:::..::......|.:.:....|  |.::||
  Fly   263 PRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTMKAAYG--HPHHPF 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 126/301 (42%)
Tas 5..297 CDD:223739 125/296 (42%)
CG6083NP_648485.1 ARA1 1..300 CDD:223729 125/296 (42%)
Tas 17..293 CDD:223739 119/276 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468210
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm1169
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
1110.800

Return to query results.
Submit another query.