DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and CG10863

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_647840.1 Gene:CG10863 / 38463 FlyBaseID:FBgn0027552 Length:316 Species:Drosophila melanogaster


Alignment Length:313 Identity:188/313 - (60%)
Similarity:236/313 - (75%) Gaps:2/313 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGV 69
            |.||.|||.::..:|||||.|...:.|.|..||||||||||||||||:||.|||.|::.||||||
  Fly     6 PYVKHNNGTQIQSIGLGTYTSLGGDCERATLHAIDVGYRHIDTAYFYENENEVGAAVQRKIAEGV 70

  Fly    70 VKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDV 134
            :|||||.:.||||..||:|:|||..|||.|.||||.|:||||||.|..|.|..||.::|.:....
  Fly    71 IKREDIHITTKLWCHFHEPKRVEYACRKTLQNFGLQYVDLYLMHWPYSYVYRGDNEMMPTDAKGE 135

  Fly   135 LQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQKALT 199
            ::|:|:|||||::.|||||:|||.:||||||||||||.|:||||:|||:.||:||.||||||.|.
  Fly   136 VELNDIDYLDTWREMEKLVELGLTKSIGVSNFNSEQLTRLLANCKIKPIHNQIECHPALNQKKLI 200

  Fly   200 AFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIPKSS 264
            |.|||||:.:|.|.|||:|.|..:.|::||..:|..|..||.|:|.|:|||||:.:|.||:||||
  Fly   201 ALCKKNDIVVTAYCPLGRPNPAEKTPNYIYDAKVQAIGDKYKKSTAQVVLRYLIEIGTIPLPKSS 265

  Fly   265 NTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            |..||.|||.||||:|.||:.|:||.|:||||::|:.  ..:..|.|||:|||
  Fly   266 NPKRIEENFQIFDFQLDAEDHAILDSYNTGERLIPMT--HAIKSKNYPFNIEF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 181/296 (61%)
Tas 5..297 CDD:223739 179/291 (62%)
CG10863NP_647840.1 ARA1 6..304 CDD:223729 181/299 (61%)
Tas 11..290 CDD:223739 170/278 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472959
Domainoid 1 1.000 244 1.000 Domainoid score I557
eggNOG 1 0.900 - - E1_COG0656
Homologene 1 1.000 - - H134145
Inparanoid 1 1.050 248 1.000 Inparanoid score I1036
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - otm51343
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - P PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
1211.800

Return to query results.
Submit another query.