DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1c12

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001014262.3 Gene:Akr1c12 / 364773 RGDID:1359406 Length:323 Species:Rattus norvegicus


Alignment Length:321 Identity:139/321 - (43%)
Similarity:186/321 - (57%) Gaps:15/321 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLNNGYEMPILGLGTYNSKD---NEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEG 68
            ||||:|:.:|.||.|||..|:   ::...|...||||||||||||..||.|.|:|:||:.||..|
  Rat     8 VKLNDGHFIPALGFGTYKPKEVPKSKSLEAAHLAIDVGYRHIDTASAYQVEEEIGQAIQSKIKAG 72

  Fly    69 VVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYK-YVDDNTLLPKNED 132
            ||||:|:|:.||||......|.|.....|.|.|..|||:||:|:|.||..| .||::   |.:|.
  Rat    73 VVKRKDMFITTKLWCSCFRTEMVRPALEKSLKNLQLDYVDLFLIHYPVPIKSSVDES---PLDEK 134

  Fly   133 DVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQ 195
            ....|..||:.||::.:||....|||:||||||||.:||.|:|  ...:.|||.|||||...|||
  Rat   135 GKFLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHLYLNQ 199

  Fly   196 KALTAFCKKNDVTLTGYTPLG----KPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLG 256
            ..|..:||..|:.|..|..||    |...|...|..:..|.:..:|||..::...|.||||...|
  Rat   200 SKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLDDPILCDVAKKNKRSPALIALRYLFQRG 264

  Fly   257 VIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            |:|:.:|...|.:.||..:|:|:|:.|:|..|||.:...|.:....:  .:|..||||.|:
  Rat   265 VVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLSAEFL--ADHPEYPFSEEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 133/304 (44%)
Tas 5..297 CDD:223739 132/299 (44%)
Akr1c12NP_001014262.3 ARA1 8..305 CDD:223729 132/299 (44%)
Tas 16..297 CDD:223739 124/283 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.