DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1c15

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001103370.1 Gene:Akr1c15 / 361267 RGDID:1307514 Length:324 Species:Rattus norvegicus


Alignment Length:326 Identity:145/326 - (44%)
Similarity:196/326 - (60%) Gaps:13/326 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLAPTVKLNNGYEMPILGLGTYNSKD---NEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIR 62
            :|.:.:||||:|..||:||.||:.||:   ::...|.|.|||||:||||.|||||||.|||:|:|
  Rat     3 LKHSRSVKLNDGNLMPVLGFGTFASKEIPKSKAAEATKVAIDVGFRHIDAAYFYQNEEEVGQALR 67

  Fly    63 DKIAEGVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLL 127
            ||:|:|.|||||:|..||:|..|..||.|.....:.|...||||:||.::|:|:..|..::  ||
  Rat    68 DKMADGTVKREDLFYTTKIWITFLRPELVRQCLERSLKKLGLDYVDLCIIHIPIAMKPGEE--LL 130

  Fly   128 PKNEDDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECS 190
            ||:.:.......||..||::|:||....||.:||||||||.:||..:|  ...:.||..|||||.
  Rat   131 PKDANGKFIFDTVDIRDTWEALEKCKDAGLSKSIGVSNFNHKQLELILNKPRLKYKPTCNQVECH 195

  Fly   191 PALNQKALTAFCKKNDVTLTGYTPLGKPKP----DIQKPDFIYSPEVAVIAKKYGKTTPQIVLRY 251
            |.|||..|..|||..|:.|..|:.||..:.    ....|..:..|.:..||||:.:|..|:.|||
  Rat   196 PYLNQSKLLEFCKSKDIVLVAYSALGSHRDSSWVSSDSPYLLEDPVLMTIAKKHNQTPGQVALRY 260

  Fly   252 LVGLGVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIE 316
            .:..||:.:.||.|..||.|||.:||||||.|:|..:|..:...|...:..  .|:|..|||..|
  Rat   261 QLQRGVVVLAKSFNEKRIKENFQVFDFELTPEDMKTIDSLNRNFRYSQMAF--ALDHPDYPFLEE 323

  Fly   317 F 317
            :
  Rat   324 Y 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 138/305 (45%)
Tas 5..297 CDD:223739 137/300 (46%)
Akr1c15NP_001103370.1 ARA1 9..306 CDD:223729 137/298 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.