DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1c13

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_006254252.1 Gene:Akr1c13 / 361266 RGDID:1308232 Length:371 Species:Rattus norvegicus


Alignment Length:299 Identity:136/299 - (45%)
Similarity:173/299 - (57%) Gaps:13/299 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KDNEGEAAVKH-AIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKREDIFLVTKLWNIFHDPE 89
            |....|||  | |||.|||||||||.||.|.|:|:||:.||..|||||||:|:.||||.....||
  Rat    79 KSKSLEAA--HLAIDAGYRHIDTAYAYQIEEEIGQAIQSKIKAGVVKREDMFITTKLWCTCFRPE 141

  Fly    90 RVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLSDVDYLDTYKAMEKLVK 154
            .|:....|.|.|..|||.|||:||.||..|..|::  .|.:|.....|..||:.||::.:||...
  Rat   142 LVKPALEKSLKNLQLDYADLYIMHYPVPMKSGDND--FPVDEKGKSLLDTVDFCDTWEMLEKCKD 204

  Fly   155 LGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQKALTAFCKKNDVTLTGYTPLG- 216
            .|||:||||||||.:||.|:|  ...:.|||.|||||...|||..|..:||..|:.|..|..|| 
  Rat   205 AGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHLYLNQSKLLDYCKSKDIVLVAYGALGT 269

  Fly   217 ---KPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIPKSSNTNRISENFDIFDF 278
               |...|...|..:..|.:..:|||..::...|.|||||..||:|:.:|...|.:.||..:|||
  Rat   270 QRYKEWVDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLVQRGVVPLAQSFKENEMRENLQVFDF 334

  Fly   279 ELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            :|:.|:|..|||.:...|.:....:.|  |..||||.|:
  Rat   335 QLSPEDMKTLDGLNKNFRYLSAEFLAG--HPEYPFSEEY 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 129/282 (46%)
Tas 5..297 CDD:223739 128/277 (46%)
Akr1c13XP_006254252.1 Tas 77..345 CDD:223739 125/269 (46%)
ARA1 89..353 CDD:223729 123/265 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.