DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1e2

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001008343.1 Gene:Akr1e2 / 307091 RGDID:1309599 Length:301 Species:Rattus norvegicus


Alignment Length:316 Identity:142/316 - (44%)
Similarity:196/316 - (62%) Gaps:27/316 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKREDIFL 77
            :::|.:||||:.:...|...|||.||::||||.|.||.|.||:|||..|::||.||||||:::|:
  Rat     2 HQIPTVGLGTWKASPGEVTDAVKVAINLGYRHFDCAYLYHNESEVGMGIKEKIKEGVVKRDELFI 66

  Fly    78 VTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLSDVDY 142
            |:|||..:|....|:..|...|....|||:||||:|.|:|:|..|.:  :|.:....:..|...:
  Rat    67 VSKLWCTYHKQSLVKTACINTLEALNLDYLDLYLIHWPMGFKPGDKD--IPLDRSGKVIPSHTSF 129

  Fly   143 LDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQKALTAFCKKN 205
            |||::|||.||..|||::|||||||.|||.|:|  ....|||:|||:||.|.||||:|..||...
  Rat   130 LDTWEAMEDLVIEGLVKNIGVSNFNHEQLDRLLNKPGLRIKPITNQIECHPYLNQKSLIDFCHGR 194

  Fly   206 DVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIPKSSNTNRIS 270
            :|::|.|.|||..:..:...|.|.   :..||||:||:..||::|:.:...:|.||||.|.:||.
  Rat   195 NVSVTAYRPLGGSRDGVHLMDDIV---IRKIAKKHGKSPAQILIRFQIQRNLIVIPKSVNPSRIR 256

  Fly   271 ENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGL---------NHKYYPFSIEF 317
            ||..:||||||.::|..|           |:|.|.|         |||.|||.||:
  Rat   257 ENIQVFDFELTEKDMEEL-----------LSLDKNLRLATFPSTENHKDYPFHIEY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 131/290 (45%)
Tas 5..297 CDD:223739 130/285 (46%)
Akr1e2NP_001008343.1 Tas 4..287 CDD:223739 134/298 (45%)
ARA1 4..282 CDD:223729 133/293 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.