DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1c13

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_006516545.1 Gene:Akr1c13 / 27384 MGIID:1351662 Length:324 Species:Mus musculus


Alignment Length:313 Identity:130/313 - (41%)
Similarity:175/313 - (55%) Gaps:23/313 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NSKDNEGEAAVK-------------HAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKREDI 75
            |..|.|.|..||             .|:||||||:||||.||.|.|:|:||:.||..|||||||:
Mouse    16 NHYDGEKEDLVKINVPKSKSLEAACLALDVGYRHVDTAYAYQVEEEIGQAIQSKIKAGVVKREDL 80

  Fly    76 FLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLSDV 140
            |:.||||.....||.|:....|.|....|||:|||:||.||..|..|::  .|.||.....|..|
Mouse    81 FITTKLWCTCFRPELVKPALEKSLKKLQLDYVDLYIMHYPVPMKSGDND--FPVNEQGKSLLDTV 143

  Fly   141 DYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQKALTAFCK 203
            |:.||::.:|:....|||:||||||||..||.|:|  ...:.|||.|||||...|||:.|..:|:
Mouse   144 DFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQRKLLDYCE 208

  Fly   204 KNDVTLTGYTPLG----KPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIPKSS 264
            ..|:.|..|..||    |...|...|..:..|.:..:|||..::...|.||||:..|::|:.:|.
Mouse   209 SKDIVLVAYGALGTQRYKEWVDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLIQRGIVPLAQSF 273

  Fly   265 NTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            ..|.:.||..:|.|:|:.|:|..|||.:...|.:|...:  ::|..|||..|:
Mouse   274 KENEMRENLQVFGFQLSPEDMKTLDGLNKNFRYLPAEFL--VDHPEYPFVEEY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 125/296 (42%)
Tas 5..297 CDD:223739 123/291 (42%)
Akr1c13XP_006516545.1 AKR_AKR1C1-35 30..309 CDD:381334 118/280 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.