DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and SPAC19G12.09

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_594424.1 Gene:SPAC19G12.09 / 2542483 PomBaseID:SPAC19G12.09 Length:284 Species:Schizosaccharomyces pombe


Alignment Length:291 Identity:95/291 - (32%)
Similarity:138/291 - (47%) Gaps:42/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MPILGLGTYNSKDNEGEA------AVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKRE 73
            :|..|:||...|..:||.      :||:|:..|:.|||.|..|.||.|||.|::    |..|.|.
pombe    12 VPAYGVGTALFKKEKGEINRTIVDSVKNALAAGFIHIDCAEVYGNEEEVGVALK----EANVPRS 72

  Fly    74 DIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLS 138
            .:|:.:|   :.|:.:.:.....:.|...|.||:||||:|.|:.:.    ...:|.:|.      
pombe    73 KLFITSK---VMHNVDNIPEALNESLRKLGTDYLDLYLLHSPIPFY----EKKIPISEG------ 124

  Fly   139 DVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQ--KALTAF 201
                   :||||..:..|||.|:|||||....|..:|....|.|..||:|..|.:.:  |.|..|
pombe   125 -------WKAMETALGTGLVHSVGVSNFRIPDLEELLKTSTITPRVNQIEFHPQVYKAAKPLVEF 182

  Fly   202 CKKNDVTLTGYTPLGKPKPDIQKP--DFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIPKSS 264
            |:...:.:.||.||.....|.|.|  :|..|.|     .||..:..||:|::....|||||..:|
pombe   183 CQSKGIIVEGYGPLSPLVRDAQGPVAEFTKSLE-----SKYHVSDTQILLKWAYSKGVIPITTTS 242

  Fly   265 NTNRISE--NFDIFDFE-LTAEEMAVLDGYH 292
            ...|:.|  |||.|..: ...:|:..|...|
pombe   243 KIERMKECLNFDSFTLDKADIDELGTLGVQH 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 95/291 (33%)
Tas 5..297 CDD:223739 95/291 (33%)
SPAC19G12.09NP_594424.1 ARA1 10..279 CDD:223729 95/291 (33%)
Tas 12..266 CDD:223739 92/282 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.