DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and SPAC2F3.05c

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_594384.1 Gene:SPAC2F3.05c / 2541958 PomBaseID:SPAC2F3.05c Length:275 Species:Schizosaccharomyces pombe


Alignment Length:296 Identity:102/296 - (34%)
Similarity:154/296 - (52%) Gaps:36/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAPTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAE 67
            |...||||||.:.|....|:|.....:...:|..|:..||||||:|..|.|||:.|:||...:.|
pombe     2 LGSFVKLNNGLKCPQFAYGSYMVNRTKCFDSVYAALQCGYRHIDSAQMYHNEADCGRAILKFMEE 66

  Fly    68 GVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNED 132
            ...|||||:..:||.::......:..| ...:...||.||||:|:|.|.|               
pombe    67 TGTKREDIWFTSKLNDLSGYKSTLSSI-DASVKACGLGYIDLFLLHSPYG--------------- 115

  Fly   133 DVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL-ANCEIKPVTNQVECSPALNQK 196
                    |.::::||:||.|:.|.:|:||||||....:..:| ::.:|.|..||:|..|..:|:
pombe   116 --------DRIESWKALEKGVEEGKLRAIGVSNFGPHHIQELLDSHPKIIPCVNQIELHPFCSQQ 172

  Fly   197 ALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIPIP 261
            .:..:|:...:.|..|.||      :....| .:.::..||.||.|:..||::||.:..|.|.:|
pombe   173 KVVDYCESKGIQLAAYAPL------VHGEKF-GNKQLLAIASKYNKSEAQIMIRYCLQRGFIVLP 230

  Fly   262 KSSNTNRISENFDIFDFELTAEEMAVL----DGYHT 293
            |||...||.||.|:||||::.|:|..|    :.||:
pombe   231 KSSTPRRIKENGDVFDFEISKEDMEKLYNLDEDYHS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 101/294 (34%)
Tas 5..297 CDD:223739 101/294 (34%)
SPAC2F3.05cNP_594384.1 ARA1 1..274 CDD:223729 102/296 (34%)
Tas 9..272 CDD:223739 98/289 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.