DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1d1

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_017176967.1 Gene:Akr1d1 / 208665 MGIID:2384785 Length:328 Species:Mus musculus


Alignment Length:278 Identity:116/278 - (41%)
Similarity:164/278 - (58%) Gaps:11/278 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLNNGYEMPILGLGTYNSK---DNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEG 68
            :.|::|..:|::|||||:..   ..:...|||.|||.||||||.||.|.||.|||:|||:|||||
Mouse    28 ISLSDGNNIPLIGLGTYSDPRPVPGKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREKIAEG 92

  Fly    69 VVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDD 133
            .||||:||...||||..|.|..|.....:.|....|||||||::.:|:.:|  ....:.|::|:.
Mouse    93 KVKREEIFYCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELPMAFK--PGKEIYPRDENG 155

  Fly   134 VLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQK 196
            .:.....:...|::|:|.....|||:|:||||||..||..:|  ...:.|||||||||.|...|.
Mouse   156 RIIYDKTNLCATWEALEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVTNQVECHPYFTQT 220

  Fly   197 ALTAFCKKNDVTLTGYTPLGKPK----PDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGV 257
            .|..||:::|:.:..::|||..:    .::..|..:....:..:.|||.||..|||||:.:..|:
Mouse   221 KLLKFCQQHDIVIVAHSPLGTCRNPSWVNVSSPPLLNDELLTSLGKKYNKTQAQIVLRFNIQRGI 285

  Fly   258 IPIPKSSNTNRISENFDI 275
            :.||||....||.|||.:
Mouse   286 VVIPKSFTPERIKENFQV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 116/278 (42%)
Tas 5..297 CDD:223739 116/278 (42%)
Akr1d1XP_017176967.1 AKR_SF 33..303 CDD:382030 115/271 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S990
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.680

Return to query results.
Submit another query.