DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1d1

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_620239.2 Gene:Akr1d1 / 192242 RGDID:620752 Length:325 Species:Rattus norvegicus


Alignment Length:320 Identity:138/320 - (43%)
Similarity:193/320 - (60%) Gaps:13/320 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLNNGYEMPILGLGTYNS-KDNEGEA--AVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEG 68
            :.||:|..:||:|||||:. :...|:.  |||.|||.||||||.||.|:||.|||:|||:|:|||
  Rat    10 IPLNDGNSIPIIGLGTYSDPRPVPGKTFIAVKTAIDEGYRHIDGAYVYRNEHEVGEAIREKVAEG 74

  Fly    69 VVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDD 133
            .||||:||...|||:..||||.|.....:.|....|||||||::.||:.:|..::  ..||:|:.
  Rat    75 KVKREEIFYCGKLWSTDHDPEMVRPALERTLQTLKLDYIDLYIIEMPMAFKPGEE--FYPKDENG 137

  Fly   134 VLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQK 196
            .:.....:...|::|:|.....|||:|:||||||..||..:|  ...:.|||||||||.|...|.
  Rat   138 RVIYHKSNLCATWEALEACKDAGLVKSLGVSNFNRRQLEVILNKPGLKYKPVTNQVECHPYFTQT 202

  Fly   197 ALTAFCKKNDVTLTGYTPLGKPK----PDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGV 257
            .|..||:::|:.:..|:|||..:    .::..|..:....:..:.|||.||..|||||:.:..|:
  Rat   203 KLLKFCQQHDIVIVAYSPLGTCRNPLWVNVSSPPLLKDELLTSLGKKYNKTQAQIVLRFDIQRGL 267

  Fly   258 IPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            :.||||:...||.|||.||||.||.|||..::..:...|.|  .::...:|..|||..|:
  Rat   268 VVIPKSTTPERIKENFQIFDFSLTKEEMKDIEALNKNVRFV--EMLMWSDHPEYPFHDEY 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 133/303 (44%)
Tas 5..297 CDD:223739 131/298 (44%)
Akr1d1NP_620239.2 AKR_AKR1D1-3 15..321 CDD:381335 133/309 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8954
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.