DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and ZK1290.5

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_495578.2 Gene:ZK1290.5 / 191555 WormBaseID:WBGene00022887 Length:321 Species:Caenorhabditis elegans


Alignment Length:305 Identity:105/305 - (34%)
Similarity:157/305 - (51%) Gaps:33/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAPTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAE 67
            :.||..|:|..|||::||||.:|.....:|.:......|||.||||..|..|.::|.|:::    
 Worm     1 MIPTTVLSNNVEMPLIGLGTTHSGGYYHDAVLHSIKKCGYRLIDTAKRYGVEKQLGIAVKN---- 61

  Fly    68 GVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPK--- 129
            ..|.||::||.||||.:....| |....:........||:|:|::|||          .||.   
 Worm    62 CSVPREEMFLSTKLWPVDCGDE-VYNAFQTSCEKLQTDYLDMYMIHMP----------QLPDWIV 115

  Fly   130 NEDDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALN 194
            |:.:..:       .|::.||.|.:...||||||||::.|.|..:|....|.|..||||..|..:
 Worm   116 NQKETKE-------KTWRQMELLYEDEHVRSIGVSNYSIEDLDELLEFASILPHANQVELHPWFH 173

  Fly   195 QKALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIP 259
            |..|..:|.:..:...||.||.|.|       ::....:..||.||.|:..||.||:.:...|..
 Worm   174 QADLKNYCDELGILTMGYCPLAKGK-------YLEDETLCKIASKYQKSPAQICLRWSIQQNVPT 231

  Fly   260 IPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGER-VVPLNLI 303
            :|||::..|:.||.::|||||:||:|..|:.:.:..| :|.|:.|
 Worm   232 VPKSTDCRRLKENTNVFDFELSAEDMNTLNSFSSQNRKIVDLSNI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 104/300 (35%)
Tas 5..297 CDD:223739 102/295 (35%)
ZK1290.5NP_495578.2 ARA1 1..268 CDD:223729 101/295 (34%)
Tas 16..261 CDD:223739 93/273 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166085
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.