DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and K07C5.2

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_505658.1 Gene:K07C5.2 / 187089 WormBaseID:WBGene00010625 Length:301 Species:Caenorhabditis elegans


Alignment Length:297 Identity:90/297 - (30%)
Similarity:143/297 - (48%) Gaps:29/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLNNGYEMPILGLG-----TYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAE 67
            |.::|||||.:|||     |....|...|||:|.    |||..|||..|:||..:|.:::..:.:
 Worm    13 KFSDGYEMPKIGLGISRIETQQDLDVSIEAALKS----GYRQFDTANLYKNETFLGNSLKKYLPQ 73

  Fly    68 GVVKREDIFLVTKLWNIFHDP-ERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNE 131
            ..:.|||:|:.||:..:..:. |..|......|:....||:||.|:|.|     .|.:|    ..
 Worm    74 FGLTREDVFITTKVRTLNENTVEETEKQLANSLATLQTDYVDLLLIHYP-----RDRDT----GN 129

  Fly   132 DDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQK 196
            ||..:::.......::.:||..:.|.||||||||:....|..:....:|:||.||.|..|.|.:.
 Worm   130 DDDYEINKSRRKIVWQTLEKAKESGRVRSIGVSNYEVYHLVEMFEYAKIRPVLNQYEYQPYLTRP 194

  Fly   197 ALTAFCKKNDVTLTGYTPLGKPKPDI--QKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVIP 259
            .|..||..|::.:..|:.|.....:|  :||       :..:.:||.:|...|:..:........
 Worm   195 TLKKFCDLNNIVVQSYSSLCWGDKEILQEKP-------LVDLCQKYNQTPQAILYAFAHCSNTSM 252

  Fly   260 IPKSSNTNRISENF-DIFDFELTAEEMAVLDGYHTGE 295
            ||||:..:||.:|. :....:||.:|:..|.....|:
 Worm   253 IPKSATPSRIHDNLHNTIKIKLTEDELKSLRSLDKGK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 90/297 (30%)
Tas 5..297 CDD:223739 90/297 (30%)
K07C5.2NP_505658.1 AKR_AKR1-5-like 20..282 CDD:381297 84/281 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.