DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and F53F1.3

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_506323.1 Gene:F53F1.3 / 186169 WormBaseID:WBGene00009981 Length:283 Species:Caenorhabditis elegans


Alignment Length:310 Identity:91/310 - (29%)
Similarity:148/310 - (47%) Gaps:50/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVV 70
            ::|||.||:.|::|||||....::....:..|:..|||..|||..|.||.|:|.|:...:.:..:
 Worm     2 SIKLNTGYDCPLIGLGTYKIIGDQVLPVLDAALTAGYRLFDTAKVYNNEKEIGDALEILLPKHNL 66

  Fly    71 KREDIFLVTKLWNIFHDPERVEGICR---KQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNED 132
            ||||||:.||:     .|..||.:.:   :.||.....|||:||:|.|..:.|.|.:   |.|: 
 Worm    67 KREDIFITTKM-----HPNTVENVKKLVDESLSLLKTSYIDMYLIHYPKSFDYGDQD---PMNK- 122

  Fly   133 DVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIK-------PVTNQVECS 190
             .|:::      |:..:.:....|.:||:|||:|....|.      |:|       |..||||..
 Worm   123 -TLRIA------TWNDLWECKNAGKIRSVGVSSFEIRHLE------ELKDLGKNFPPCCNQVEYH 174

  Fly   191 PALNQKALTAFCKKNDVTLTGYTPLGKPKPDIQKPDFIYSPEVAV-IAKKYGKTTPQIVLRYLVG 254
            |...::.|..:||...:....::.|.:..      :.:.|.|:.. :|:||......::|.:...
 Worm   175 PHFTREELKNYCKSEGIFFQAFSSLARHN------ETLLSSEIITRLAEKYHVPKTTVLLSWATS 233

  Fly   255 LGVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIK 304
            ..|..||||:|..|:::|..    .:..||..|       :::..|||.|
 Worm   234 QKVGIIPKSTNPERLAQNLK----TVLLEEEEV-------KKICNLNLDK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 88/306 (29%)
Tas 5..297 CDD:223739 87/301 (29%)
F53F1.3NP_506323.1 AKR_AKR1-5-like 12..265 CDD:381297 82/291 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166061
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.