DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and C56G3.2

DIOPT Version :10

Sequence 1:NP_729808.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001367459.1 Gene:C56G3.2 / 183870 WormBaseID:WBGene00016985 Length:131 Species:Caenorhabditis elegans


Alignment Length:84 Identity:28/84 - (33%)
Similarity:45/84 - (53%) Gaps:12/84 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDVLQLSDVDYLDTYKAMEKL 152
            |.|:||..|..|....|:|:||||.|||..:            .||:.|..:....|.::..:.:
 Worm    59 PGRLEGALRDSLKKLHLEYVDLYLAHMPTAF------------SDDMSQKIESSVEDIWRQFDAV 111

  Fly   153 VKLGLVRSIGVSNFNSEQL 171
            .|.||.:::||||:|::|:
 Worm   112 YKAGLAKAVGVSNWNNDQI 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_729808.1 AKR_AKR2E1-5 5..298 CDD:381342 28/84 (33%)
C56G3.2NP_001367459.1 AKR_SF <51..>131 CDD:444925 28/84 (33%)

Return to query results.
Submit another query.