DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and C07D8.5

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_509243.1 Gene:C07D8.5 / 182366 WormBaseID:WBGene00015564 Length:134 Species:Caenorhabditis elegans


Alignment Length:77 Identity:40/77 - (51%)
Similarity:54/77 - (70%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGVVKRE 73
            |:|.:.||.:||||:.|...:..:|||.|:..||..||||..|.||..:|.||::.|||||||||
 Worm    50 LSNAHSMPAVGLGTWQSNAEDVISAVKAAVKNGYSLIDTASGYNNEEFIGTAIKEVIAEGVVKRE 114

  Fly    74 DIFLVTKLWNIF 85
            |:|:.||:.|:|
 Worm   115 DLFITTKVPNLF 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 40/77 (52%)
Tas 5..297 CDD:223739 40/77 (52%)
C07D8.5NP_509243.1 AKR_SF 45..>126 CDD:382030 39/75 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166103
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.