DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and ZC443.1

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_506205.1 Gene:ZC443.1 / 179756 WormBaseID:WBGene00013896 Length:320 Species:Caenorhabditis elegans


Alignment Length:332 Identity:124/332 - (37%)
Similarity:181/332 - (54%) Gaps:38/332 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGV 69
            |...|:||..||.:||||:.....||:..:::|:..||||||||..||||.::|.|:.:..|||:
 Worm     6 PIFTLSNGVLMPSIGLGTWQMTGEEGKTVIRNAVLAGYRHIDTATLYQNEHQIGDALAELFAEGI 70

  Fly    70 VKREDIFLVTKLWNIFHD--PERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNED 132
            :||||||:.||.:  .|:  |:.||...|..|....|||:||||.|:|...|            |
 Worm    71 LKREDIFITTKAF--CHEVAPDVVEEALRNSLKRLRLDYVDLYLAHIPASTK------------D 121

  Fly   133 DVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPV-TNQVECSPALNQK 196
            |....|||...|.::..||:..|||.::|||||||..|:.|:: |.:..|: .:|:|....|.||
 Worm   122 DGSFRSDVKVEDIWRGFEKVYGLGLTKAIGVSNFNESQIVRIM-NIQKVPIHASQLELHLYLPQK 185

  Fly   197 ALTAFCKKNDVTLTGYTPLGKP----------KPDIQ----KPDFIYSPEVAVIAKKYGKTTPQI 247
            |....|||:::.:|.|..||.|          :|..:    ..:.:....|..:|:||.||..||
 Worm   186 AHRELCKKHNILITAYATLGSPGRMSVVGSNGRPLFESTQNSENEMNDKHVKALAQKYSKTPAQI 250

  Fly   248 VLRYLVGLGVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLN---HK 309
            :||..|.:|:|.|||::|..|:.||.:||||.::..|:.:|:.:   ||.....|....|   |.
 Worm   251 LLRATVEMGIIVIPKTTNPERMKENINIFDFNISNAEVNLLEAH---ERTKQERLFWWPNVADHP 312

  Fly   310 YYPFSIE 316
            ..||:.:
 Worm   313 EDPFATQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 119/313 (38%)
Tas 5..297 CDD:223739 118/308 (38%)
ZC443.1NP_506205.1 AKR_AKR1G1_CeAKR 5..303 CDD:381380 119/314 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I1629
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm4839
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.