DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and exc-15

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001367925.1 Gene:exc-15 / 178844 WormBaseID:WBGene00020369 Length:333 Species:Caenorhabditis elegans


Alignment Length:315 Identity:125/315 - (39%)
Similarity:186/315 - (59%) Gaps:11/315 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TVKLNNGYEMPILGLGTYNSKDN-EGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEGV 69
            ::.||.|.::|:.||||:..||. |...|::.|:|.|||.||||:.||||..:||.:.:.|:.|.
 Worm     5 SIPLNTGAQLPLFGLGTWQVKDEAELTVALRAALDAGYRLIDTAHLYQNEHIIGKVLHEYISSGK 69

  Fly    70 VKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDDV 134
            :||||||:.:||....|.||.|......||....|:||||||:|.|..:|: .:.:..|..|:..
 Worm    70 LKREDIFVTSKLPFTAHAPEDVPKCVESQLKALQLEYIDLYLIHCPFPFKH-QEGSFAPLMENGE 133

  Fly   135 LQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQKALT 199
            |.::::.::||::|:|||.|.|.::::|||||:..||..:....|:||...||||.....|:.|.
 Worm   134 LAVTEIAHIDTWRALEKLYKEGKLKALGVSNFSCNQLQALYDAAEVKPANQQVECHIYWPQQELR 198

  Fly   200 AFCKKNDVTLTGYTPLGKPKPDIQKPDFIY-------SPEVAVIAKKYGKTTPQIVLRYLVGLGV 257
            |.|||..||:|.|.|||.|.....:||.::       .|.|..:|.||.||..||::|:|...|:
 Worm   199 ALCKKLGVTVTAYAPLGSPGRKAARPDGVWPEGDPLLEPIVKQLAAKYHKTAAQILIRHLTQHGI 263

  Fly   258 IPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYP 312
            ..||||.:.:||.||...|||:|:.|:|..|:...|..|:...:.  .:.|.::|
 Worm   264 STIPKSVSPDRIVENISTFDFKLSDEDMHTLNSIETRTRLFIADF--AVKHPFFP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 123/303 (41%)
Tas 5..297 CDD:223739 122/298 (41%)
exc-15NP_001367925.1 AKR_AKR1G1_CeAKR 3..306 CDD:381380 123/301 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.