DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Y39G8B.1

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001370070.1 Gene:Y39G8B.1 / 175047 WormBaseID:WBGene00012722 Length:316 Species:Caenorhabditis elegans


Alignment Length:319 Identity:140/319 - (43%)
Similarity:196/319 - (61%) Gaps:7/319 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAPTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAE 67
            :..::|||:||.:|.:||||:.||..|..||:|.|:..||||||.|:.|||:.|||:|:::.:.|
 Worm     1 MVQSLKLNSGYSIPAIGLGTWQSKPGEVAAAIKTAVAAGYRHIDCAHVYQNQKEVGEALKEILDE 65

  Fly    68 GVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNED 132
            |.||||::|:.:|:||.||...:........||:..|.|:||.|:|.|.|  |.:...|.|..|:
 Worm    66 GKVKREELFITSKVWNTFHSEAKAHENIDIILSDLQLSYVDLMLIHWPQG--YAEGAELFPAGEN 128

  Fly   133 DVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQKA 197
            ..::.||||||:|:||.|...|.|..||||:|||...|:.||....|:||...|||..|...|..
 Worm   129 GKMRYSDVDYLETWKAFEAAQKAGKCRSIGLSNFTHSQIQRVWDAAEVKPACLQVELHPYFTQVK 193

  Fly   198 LTAFCKKNDVTLTGYTPLGKPKPDIQK----PDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGVI 258
            |..|||:..:.:.||:|||.|.....:    |:.:.:..||.|||.:|||..||:||:.|..|:.
 Worm   194 LREFCKEKGIVVVGYSPLGNPGSAFFRKDGDPNVLTNEVVAGIAKAHGKTPAQIILRWFVDSGLS 258

  Fly   259 PIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            .||||....|||||..:|||:|||||::.:||.:...|:|.|:...| :|.:.||..||
 Worm   259 AIPKSVTPQRISENLAVFDFQLTAEEISKIDGINKNWRIVDLSQRDG-DHPHCPFLEEF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 134/300 (45%)
Tas 5..297 CDD:223739 131/295 (44%)
Y39G8B.1NP_001370070.1 AKR_SF 7..305 CDD:412396 133/299 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm8417
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.