DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and AKR1C1

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001344.2 Gene:AKR1C1 / 1645 HGNCID:384 Length:323 Species:Homo sapiens


Alignment Length:323 Identity:143/323 - (44%)
Similarity:193/323 - (59%) Gaps:19/323 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLNNGYEMPILGLGTY------NSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKI 65
            ||||:|:.||:||.|||      .||..|   |.|.||:.|:||||:|:.|.||.:||.|||.||
Human     8 VKLNDGHFMPVLGFGTYAPAEVPKSKALE---ATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI 69

  Fly    66 AEGVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKN 130
            |:|.|||||||..:|||...|.||.|.....:.|.|..|||:||||:|.||..|..::  ::||:
Human    70 ADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEE--VIPKD 132

  Fly   131 EDDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPAL 193
            |:..:....||...|::|:||....||.:||||||||..||..:|  ...:.|||.|||||.|..
Human   133 ENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYF 197

  Fly   194 NQKALTAFCKKNDVTLTGYTPLG----KPKPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVG 254
            ||:.|..|||..|:.|..|:.||    :|..|...|..:..|.:..:|||:.:|...|.|||.:.
Human   198 NQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQ 262

  Fly   255 LGVIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            .||:.:.||.|..||.:|..:|:|:||:|||..:||.:...|.:.|::..|..:  ||||.|:
Human   263 RGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPN--YPFSDEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 137/306 (45%)
Tas 5..297 CDD:223739 135/301 (45%)
AKR1C1NP_001344.2 AKR_AKR1C1-35 6..308 CDD:381334 136/304 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.