DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Gclm

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_032155.1 Gene:Gclm / 14630 MGIID:104995 Length:274 Species:Mus musculus


Alignment Length:200 Identity:48/200 - (24%)
Similarity:83/200 - (41%) Gaps:55/200 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KREDIFLVTKLWNIFHDP-----ERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKN 130
            :||::.:..||:.:..:.     ..|:..|    |..|:..:|..:|..|.    ::|...|   
Mouse    85 EREEMKVSAKLFIVGSNSSSSTRSAVDMAC----SVLGVAQLDSVIMASPP----IEDGVNL--- 138

  Fly   131 EDDVLQLSDVDYLDTY-KAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVE-CSPAL 193
                    .:::|..| :.:|.||:...:.:||.|:.:..||.::....::||.:|||. .|..:
Mouse   139 --------SLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCV 195

  Fly   194 NQKALTAFCKKNDVTLTGYTPLGKPK----------------PDIQKPDFI------YSPEVAVI 236
            ....||||.|:.|:.|..:   ..||                |||:..|::      ||    ||
Mouse   196 MPPDLTAFAKQFDIQLLTH---NDPKELLSEASFQEALQESIPDIEAQDWVPLWLLRYS----VI 253

  Fly   237 AKKYG 241
            .|..|
Mouse   254 VKSRG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 47/199 (24%)
Tas 5..297 CDD:223739 47/199 (24%)
GclmNP_032155.1 AKR_SF <109..>211 CDD:412396 31/120 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.