Sequence 1: | NP_001287050.1 | Gene: | CG10638 / 39424 | FlyBaseID: | FBgn0036290 | Length: | 317 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032155.1 | Gene: | Gclm / 14630 | MGIID: | 104995 | Length: | 274 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 48/200 - (24%) |
---|---|---|---|
Similarity: | 83/200 - (41%) | Gaps: | 55/200 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 KREDIFLVTKLWNIFHDP-----ERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKN 130
Fly 131 EDDVLQLSDVDYLDTY-KAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVE-CSPAL 193
Fly 194 NQKALTAFCKKNDVTLTGYTPLGKPK----------------PDIQKPDFI------YSPEVAVI 236
Fly 237 AKKYG 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10638 | NP_001287050.1 | ARA1 | 5..302 | CDD:223729 | 47/199 (24%) |
Tas | 5..297 | CDD:223739 | 47/199 (24%) | ||
Gclm | NP_032155.1 | AKR_SF | <109..>211 | CDD:412396 | 31/120 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0656 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |