DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1b7

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_033861.2 Gene:Akr1b7 / 11997 MGIID:101918 Length:316 Species:Mus musculus


Alignment Length:320 Identity:135/320 - (42%)
Similarity:200/320 - (62%) Gaps:9/320 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAPTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAE 67
            :|..|:|:...:||::||||:.|...:.:.|||.|||.||||||.||.|.||.|||:||::||.|
Mouse     1 MATFVELSTKAKMPLVGLGTWKSSPGQVKEAVKAAIDAGYRHIDCAYVYHNENEVGEAIQEKIKE 65

  Fly    68 GVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNED 132
            ..|||||:|:|:|||..|.:...|:...:..||:..|||:||||:|.|.|::  ..|.||||:..
Mouse    66 NAVKREDLFIVSKLWATFFEKSLVKKAFQNTLSDLKLDYLDLYLVHWPQGFQ--AGNALLPKDNK 128

  Fly   133 DVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQ 195
            ..:.||...:||.::|||:||..|||:::|:||||..|:.|:|  ...:.||||||:|..|.|.|
Mouse   129 GKVLLSKSTFLDAWEAMEELVDQGLVKALGISNFNHFQIERLLNKPGLKHKPVTNQIESHPYLTQ 193

  Fly   196 KALTAFCKKNDVTLTGYTPLGKPKPDIQKPD---FIYSPEVAVIAKKYGKTTPQIVLRYLVGLGV 257
            :.|..:|:...:.:|.|:|||.|.....||:   .:..|::..||.|:.||..|:::|:.|...|
Mouse   194 EKLIQYCQSKGIAVTAYSPLGSPDRPYAKPEDPVVMEIPKIKEIAAKHKKTVAQVLIRFHVQRNV 258

  Fly   258 IPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            :.||||...:||.||..:|||:|:.|:||.:..::...|.  .:|:.....:.|||..|:
Mouse   259 VVIPKSVTPSRIQENLQVFDFQLSEEDMAAILSFNRNWRA--CDLLDARTEEDYPFHEEY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 129/301 (43%)
Tas 5..297 CDD:223739 128/296 (43%)
Akr1b7NP_033861.2 AKR_AKR1B1-19 10..316 CDD:381333 131/309 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.