DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1c20

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001298061.1 Gene:Akr1c20 / 116852 MGIID:2151104 Length:323 Species:Mus musculus


Alignment Length:321 Identity:138/321 - (42%)
Similarity:189/321 - (58%) Gaps:13/321 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TVKLNNGYEMPILGLGTYNSKD---NEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAE 67
            ||.||:|:.:||||.||...::   ::...|.|.|||.|:||||.|..||||.|||.|||.||.:
Mouse     7 TVLLNDGHFIPILGFGTSAPQEVPRSKATEATKIAIDAGFRHIDCAAVYQNEKEVGLAIRSKIVD 71

  Fly    68 GVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNED 132
            |.|||||||..:|:|..||.||.|:....:.|....|||:||||:|.|:..|  ......||:|:
Mouse    72 GTVKREDIFCTSKVWQTFHRPELVQVCLEQSLKQLQLDYVDLYLIHFPIAMK--PGENYFPKDEN 134

  Fly   133 DVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLA--NCEIKPVTNQVECSPALNQ 195
            .......||..||::||||....||.:||||.|||..||.::|:  ..:.|||.|||||.|.|||
Mouse   135 GKFIYDAVDICDTWEAMEKCKDAGLAKSIGVCNFNRRQLEKILSKPGLKYKPVCNQVECHPYLNQ 199

  Fly   196 KALTAFCKKNDVTLTGYTPLG--KPKPDIQK--PDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLG 256
            :.|..||:..|:.|..::.||  :.|..:.|  |..:..|.:..:||||.:|...|.|||.|..|
Mouse   200 RKLLDFCRSKDIVLVAHSALGSNRDKEWVDKSFPVLLDDPVLGSMAKKYNRTPALIALRYQVQRG 264

  Fly   257 VIPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            |:.:.||....||.||..:|:|:||:.:|.||||.:...|.:..::.:  :|..:||..|:
Mouse   265 VVVLAKSFIEKRIKENMQVFEFQLTSVDMKVLDGLNKNIRYIGSSISE--DHPDFPFLDEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 134/304 (44%)
Tas 5..297 CDD:223739 133/299 (44%)
Akr1c20NP_001298061.1 ARA1 5..317 CDD:223729 135/313 (43%)
Tas 16..297 CDD:223739 125/282 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.