DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and AKR1C4

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001809.4 Gene:AKR1C4 / 1109 HGNCID:387 Length:323 Species:Homo sapiens


Alignment Length:320 Identity:140/320 - (43%)
Similarity:188/320 - (58%) Gaps:13/320 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLNNGYEMPILGLGTYNSKD---NEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEG 68
            |:||:|:.||:||.|||...:   |......|.||:.|:||||:||.|.||.:||.|||.|||:|
Human     8 VELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADG 72

  Fly    69 VVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDD 133
            .|||||||..:|||..|..|:.|:......|....|||:||||:|.|:..|  ...|.|||:|:.
Human    73 SVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPMALK--PGETPLPKDENG 135

  Fly   134 VLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQK 196
            .:....||...|::.|||....||.:||||||||..||..:|  ...:.|||.|||||.|.|||.
Human   136 KVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKPGLKYKPVCNQVECHPYLNQS 200

  Fly   197 ALTAFCKKNDVTLTGYTPLGKPK----PDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGV 257
            .|..|||..|:.|..::.||..:    .|...|..:..|.:..:|||:.:|...|.|||.:..||
Human   201 KLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPVLCALAKKHKQTPALIALRYQLQRGV 265

  Fly   258 IPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            :.:.||.|..||.||..:|:|:||:|:|.||||.:...|.|.::.:  ::|..||||.|:
Human   266 VVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFL--MDHPDYPFSDEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 134/303 (44%)
Tas 5..297 CDD:223739 132/298 (44%)
AKR1C4NP_001809.4 AKR_AKR1C1-35 6..306 CDD:381334 133/299 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.