DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and Akr1c18

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_598827.1 Gene:Akr1c18 / 105349 MGIID:2145420 Length:323 Species:Mus musculus


Alignment Length:320 Identity:138/320 - (43%)
Similarity:188/320 - (58%) Gaps:13/320 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLNNGYEMPILGLGTYNSKDN---EGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEG 68
            ::||:|:.:|:||.|||.::::   :...:.|.|||||:.|||.::.||||.|:|:||..||.:|
Mouse     8 IELNDGHSIPVLGFGTYATEEHLKKKSMESTKIAIDVGFCHIDCSHLYQNEEEIGQAILSKIEDG 72

  Fly    69 VVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDD 133
            .|||||||..:|||:..|.||.|.......|....|||:||||:|.||..|  ..|.||||:|..
Mouse    73 TVKREDIFYTSKLWSTSHRPELVRPSLENSLRKLNLDYVDLYLIHFPVSLK--PGNELLPKDEHG 135

  Fly   134 VLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQK 196
            .|....||..||::||||....||.:||||||||..||..:|  ...:.|||.|||||...|||.
Mouse   136 NLIFDTVDLCDTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHLYLNQS 200

  Fly   197 ALTAFCKKNDVTLTGYTPLGKPK----PDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGV 257
            .|.|:||.||:.|..|..||..:    .:...|..:..|.:..:||||.:|...|.|||.:..|:
Mouse   201 KLLAYCKMNDIVLVAYGALGTQRYKYCINEDTPVLLDDPVLCAMAKKYKRTPALIALRYQLDRGI 265

  Fly   258 IPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGERVVPLNLIKGLNHKYYPFSIEF 317
            :.:.||.|..||.||..:|||:|.:::|.:|||.....|..|.::.|.  |..:||..|:
Mouse   266 VALAKSFNEERIRENMQVFDFQLASDDMKILDGLDRNLRYFPADMFKA--HPNFPFFDEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 133/303 (44%)
Tas 5..297 CDD:223739 131/298 (44%)
Akr1c18NP_598827.1 ARA1 7..310 CDD:223729 133/303 (44%)
Tas 15..297 CDD:223739 125/283 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.