DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and AKR1A1

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001189342.1 Gene:AKR1A1 / 10327 HGNCID:380 Length:325 Species:Homo sapiens


Alignment Length:324 Identity:133/324 - (41%)
Similarity:195/324 - (60%) Gaps:17/324 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 APTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEG 68
            |..|.|:.|.:||::||||:.|:..:.:||||:|:.|||||||.|..|.||.|:|:|:::.:..|
Human     3 ASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPG 67

  Fly    69 -VVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNED 132
             .|.||::|:.:||||..|.||.||...||.|::..|:|:||||||.|..::..|:.  .|||.|
Human    68 KAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNP--FPKNAD 130

  Fly   133 DVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVTNQVECSPALNQKA 197
            ..:......|.:|:||:|.||..|||:::|:|||||.|:..:|:...::|...||||.|.|.|..
Human   131 GTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNE 195

  Fly   198 LTAFCKKNDVTLTGYTPLGKP-----KPDIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGLGV 257
            |.|.|:...:.:|.|:|||..     .||  :|..:..|.|..:|:|||::..||:||:.|...|
Human   196 LIAHCQARGLEVTAYSPLGSSDRAWRDPD--EPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKV 258

  Fly   258 IPIPKSSNTNRISENFDIFDFELTAEEMAVLDGYHTGER-VVPLNLIKG------LNHKYYPFS 314
            |.||||...:||.:|..:|||..:.|||..|:..:...| :||:..:.|      ..|..|||:
Human   259 ICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFN 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 127/303 (42%)
Tas 5..297 CDD:223739 125/298 (42%)
AKR1A1NP_001189342.1 ARA1 6..303 CDD:223729 127/300 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.690

Return to query results.
Submit another query.