DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and LOC101733893

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_031746807.1 Gene:LOC101733893 / 101733893 -ID:- Length:290 Species:Xenopus tropicalis


Alignment Length:281 Identity:130/281 - (46%)
Similarity:172/281 - (61%) Gaps:11/281 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PTVKLNNGYEMPILGLGTYNSK---DNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIA 66
            |.|:||:|::||:||.|||..:   .:..|...|.||||||||||.|:.|.||.|||:||:.|||
 Frog     7 PCVELNDGHKMPVLGFGTYAPEKFPKSLAEEGTKVAIDVGYRHIDCAFIYGNEVEVGRAIKAKIA 71

  Fly    67 EGVVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNE 131
            :|.|||||:|...|||:.||.||||.....|.|::..|||:||:::|.||.:|..||.  ||.:|
 Frog    72 DGTVKREDVFYTGKLWSTFHTPERVRPALEKSLTDLQLDYMDLFIIHNPVEFKPGDDP--LPLDE 134

  Fly   132 DDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALN 194
            :......:.|..||:||:||....||||||||||||.:||..:|  ...:.|||.|||||...|:
 Frog   135 NGKPIFHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHIYLD 199

  Fly   195 QKALTAFCKKNDVTLTGYTPLGKPKP----DIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLVGL 255
            |..|..|||..|:.|..|..||..:.    |...|..:.:|.:..||||:.:|...:.:|||:..
 Frog   200 QSKLLEFCKSKDIVLVAYGVLGSSREENWVDQSTPVLLENPILGAIAKKHNRTPAHVAMRYLLQR 264

  Fly   256 GVIPIPKSSNTNRISENFDIF 276
            ||:.:.||....||.|||.:|
 Frog   265 GVVVLAKSFTPARIKENFKVF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 130/281 (46%)
Tas 5..297 CDD:223739 130/281 (46%)
LOC101733893XP_031746807.1 AKR_AKR1C1-35 7..286 CDD:381334 130/281 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 1 1.000 - - mtm9378
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.