DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10638 and LOC100494522

DIOPT Version :9

Sequence 1:NP_001287050.1 Gene:CG10638 / 39424 FlyBaseID:FBgn0036290 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_031746808.1 Gene:LOC100494522 / 100494522 -ID:- Length:263 Species:Xenopus tropicalis


Alignment Length:256 Identity:119/256 - (46%)
Similarity:158/256 - (61%) Gaps:11/256 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VKLNNGYEMPILGLGTYNSK---DNEGEAAVKHAIDVGYRHIDTAYFYQNEAEVGKAIRDKIAEG 68
            |:||:|::||:||.|||..:   .:..|...|.||||||||||.|:.|.||.|||:||:.|||:|
 Frog     9 VELNDGHKMPVLGFGTYAPEKFPKSLAEEGTKVAIDVGYRHIDCAFIYGNEVEVGRAIKAKIADG 73

  Fly    69 VVKREDIFLVTKLWNIFHDPERVEGICRKQLSNFGLDYIDLYLMHMPVGYKYVDDNTLLPKNEDD 133
            .|||||:|...|||:.||.||||.....|.|::..|||:||:::|.||.:|..||.  ||.:|:.
 Frog    74 TVKREDVFYTGKLWSTFHTPERVRPALEKSLTDLQLDYMDLFIIHNPVEFKPGDDP--LPLDENG 136

  Fly   134 VLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVL--ANCEIKPVTNQVECSPALNQK 196
            .....:.|..||:||:||....||||||||||||.:||..:|  ...:.|||.|||||...|:|.
 Frog   137 KPIFHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECPIYLDQS 201

  Fly   197 ALTAFCKKNDVTLTGYTPLGKPKP----DIQKPDFIYSPEVAVIAKKYGKTTPQIVLRYLV 253
            .|..|||..|:.|..|..||..:.    |...|..:.:|.:..||||:.:|...:.:|||:
 Frog   202 KLLEFCKSKDIVLVAYGVLGSSREENWVDQSTPVLLENPILGAIAKKHNRTPAHVAMRYLL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10638NP_001287050.1 ARA1 5..302 CDD:223729 119/256 (46%)
Tas 5..297 CDD:223739 119/256 (46%)
LOC100494522XP_031746808.1 AKR_SF 8..263 CDD:412396 119/256 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.