powered by:
Protein Alignment tal2 and CG33557
DIOPT Version :9
Sequence 1: | NP_958496.3 |
Gene: | tal2 / 394239 |
ZFINID: | ZDB-GENE-040115-1 |
Length: | 109 |
Species: | Danio rerio |
Sequence 2: | NP_001014730.1 |
Gene: | CG33557 / 3346145 |
FlyBaseID: | FBgn0053557 |
Length: | 150 |
Species: | Drosophila melanogaster |
Alignment Length: | 53 |
Identity: | 30/53 - (56%) |
Similarity: | 37/53 - (69%) |
Gaps: | 0/53 - (0%) |
- Green bases have known domain annotations that are detailed below.
Zfish 8 NTRERWRQHNVNTAFAELRKLIPTHPPEKKLSKNEILRLAMRYINFLVTLLES 60
|.|||:|..|||:|:..||.||||.|..:||||.||:|||..||..|.:.||:
Fly 67 NARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLET 119
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tal2 | NP_958496.3 |
HLH |
8..60 |
CDD:197674 |
29/51 (57%) |
CG33557 | NP_001014730.1 |
HLH |
67..119 |
CDD:197674 |
29/51 (57%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000894 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.