DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and SEC14

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:60/255 - (23%)
Similarity:100/255 - (39%) Gaps:46/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ENIRRQALAQFREWIEKHPHIRKCRTDTVFLLRFLRTKKFSVPSACEMLERYLTIRQLFPQWFKQ 111
            ::.:.:|||:.|:.:|....|.  |.|...||||||.:||.|..|.||.|.       ..:|.|.
Yeast    30 DSAQEKALAELRKLLEDAGFIE--RLDDSTLLRFLRARKFDVQLAKEMFEN-------CEKWRKD 85

  Fly   112 LDIN----------DPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDPYKFTSV--QMARVHS 164
            ...:          .|.|.:.:...|    .:.|..||.|.|......:.::...|  :...:.:
Yeast    86 YGTDTILQDFHYDEKPLIAKFYPQYY----HKTDKDGRPVYFEELGAVNLHEMNKVTSEERMLKN 146

  Fly   165 LVCEALLDDED---------SQVAGYVYINDESGMNMGFVSLWSLTDLRSIVK----CIQNSTPM 216
            ||.|.    |.         |:.||::.....:.|::..:|:.|...:.|.|:    ..||..|.
Yeast   147 LVWEY----ESVVQYRLPACSRAAGHLVETSCTIMDLKGISISSAYSVMSYVREASYISQNYYPE 207

  Fly   217 RHKETHFVNIPHYANRIIELGVSMLSDKLKKRIIV---HKNVDILKTKIDPAILPKEYGG 273
            |..:.:.:|.|...:....|....|......:|.:   ....::|| :|....||.::||
Yeast   208 RMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGSSYQKELLK-QIPAENLPVKFGG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 21/45 (47%)
CRAL_TRIO 126..274 CDD:279044 35/166 (21%)
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 21/53 (40%)
SEC14 99..269 CDD:214706 37/177 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.