DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and SFH5

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:161 Identity:30/161 - (18%)
Similarity:59/161 - (36%) Gaps:40/161 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 RQVIFSVAAKFDPYKFTSVQMARVHSLVCEALLDDEDSQVAGYVYINDESGMNMGFVSLWSL-TD 202
            ::.:|....||..|:...::...       :|||...|.......::|..|     ||:|.: :|
Yeast   134 KKELFQNVDKFVRYRIGLMEKGL-------SLLDFTSSDNNYMTQVHDYKG-----VSVWRMDSD 186

  Fly   203 LRSIVKCI----QNSTPMRHKETHFVNIPHYANRIIELGVSMLSDKLKKRIIV------------ 251
            :::..|.:    |...|......:|||:|.....:.:|....:.:..:|:.:|            
Yeast   187 IKNCSKTVIGIFQKYYPELLYAKYFVNVPTVFGWVYDLIKKFVDETTRKKFVVLTDGSKLGQYLK 251

  Fly   252 ----------HKNVDILKTKIDPAILPKEYG 272
                      .|..::.|..: ..:.|.|||
Yeast   252 DCPYEGYGGKDKKNNLTKQNV-TNVHPTEYG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024
CRAL_TRIO 126..274 CDD:279044 30/161 (19%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 24/140 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.