DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and SEC14L6

DIOPT Version :10

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_047297437.1 Gene:SEC14L6 / 730005 HGNCID:40047 Length:449 Species:Homo sapiens


Alignment Length:93 Identity:21/93 - (22%)
Similarity:41/93 - (44%) Gaps:6/93 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 MGFVSLW--SLTDLRSIVKCIQNSTPMRHKETHFVNIPHYANRIIELGVSMLSDKLKKRIIV--- 251
            :|...||  .:..|:.....::.:.|...|....|..|........|..|.:|::.::::::   
Human   290 LGLRDLWKPGIELLQEFFSALEANYPEILKSLIVVRAPKLFAVAFNLVKSYMSEETRRKVVILGD 354

  Fly   252 HKNVDILKTKIDPAILPKEYGGTVPIAD 279
            :...::.|. |.|..||.|:|||:...|
Human   355 NWKQELTKF-ISPDQLPVEFGGTMTDPD 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024
CRAL_TRIO 126..273 CDD:459890 17/85 (20%)
SEC14L6XP_047297437.1 SEC14 <272..376 CDD:469559 18/86 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.