DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and ttpal

DIOPT Version :10

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001016176.1 Gene:ttpal / 548930 XenbaseID:XB-GENE-976635 Length:338 Species:Xenopus tropicalis


Alignment Length:177 Identity:39/177 - (22%)
Similarity:56/177 - (31%) Gaps:72/177 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 ASNQVSRQKAMGDLQKMQSEKLG--KLSDIQCTPESQLKFIAEAWLQIIECRRVLKWTYAYGYYL 436
            :|..|.||...   :...|..||  ||.|:.|:..|                             
 Frog    19 SSKDVVRQLCQ---ESFSSSALGLKKLLDVTCSSLS----------------------------- 51

  Fly   437 QDHAKKPFFEYLQGEAESGLERLHKCVE----KDIEVFE--LAEGPSEEFNHFRTKLTGLTSITK 495
                      ..|.|||..|:.||:...    :|:...|  ||..|    .:|...|..|  :||
 Frog    52 ----------VTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFP----ENFHQNLKNL--LTK 100

  Fly   496 TFFENLVKA------LENGLADVDSQ----------AASSKPANSKP 526
            ...|:::.|      ||:|..::..|          |....|..|:|
 Frog   101 IILEHVLSATPGRSGLESGYQNLLRQHQPHGRPHLPAPDEDPRRSQP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024
CRAL_TRIO 126..273 CDD:459890
ttpalNP_001016176.1 CRAL_TRIO_N 53..99 CDD:215024 15/51 (29%)
SEC14 125..274 CDD:469559 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.