DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and Sec14l4

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001102560.1 Gene:Sec14l4 / 498399 RGDID:1565810 Length:412 Species:Rattus norvegicus


Alignment Length:253 Identity:61/253 - (24%)
Similarity:111/253 - (43%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RRQALAQFREWIEK-HPHIRKCRTDTVFLLRFLRTKKFSVPSACEMLERYLTIRQLFPQWFKQLD 113
            :::||.:|||.::. .|.:.|  .|..||||:||.:.|.:..:.:||.:::..|       .|.|
  Rat    12 QQEALTRFREILQDVLPTLPK--ADDFFLLRWLRARNFDLKKSEDMLRKHVEFR-------NQQD 67

  Fly   114 IN------DPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDP---YKFTSVQ-MARVHSLVCE 168
            ::      .|.:..::::|.|...   |..|..|.|.:....||   :...|.| :.|....|||
  Rat    68 LDHILTWQPPEVIRLYDSGGLCGY---DYEGCPVWFDLIGTLDPKGLFMSASKQDLIRKRIKVCE 129

  Fly   169 ALLDDEDSQ-------VAGYVYINDESGMNMGFVSLW--SLTDLRSIVKCIQNSTPMRHKETHFV 224
            .||.:.:.|       |...|.:.|..|:::.  .||  ::...:.....::.:.|...|....:
  Rat   130 MLLHECELQSQKLGRKVERMVMVFDMEGLSLR--HLWKPAVEVYQQFFAILEANYPETVKNLIVI 192

  Fly   225 NIPHYANRIIELGVSMLSDKLKKRIIV---HKNVDILKTKIDPAILPKEYGGTVPIAD 279
            ..|........|..|.:.:..:|:|::   :...::||. :.|..||.|:|||:...|
  Rat   193 RAPKLFPVAFNLVKSFIGEVTQKKIVILGGNWKQELLKF-MSPDQLPVEFGGTMTDPD 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 17/46 (37%)
CRAL_TRIO 126..274 CDD:279044 37/163 (23%)
Sec14l4NP_001102560.1 CRAL_TRIO_N 13..59 CDD:215024 17/47 (36%)
SEC14 76..244 CDD:214706 38/173 (22%)
GOLD_2 284..379 CDD:404736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.