DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and CG11550

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster


Alignment Length:305 Identity:79/305 - (25%)
Similarity:139/305 - (45%) Gaps:18/305 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KEELHEDE-----NIRRQALAQFREWIEKHPHIRKCRTDTVFLLRFLRTKKFSVPSACEMLERYL 99
            ||...||:     .|||..:.:|.:||...|||.. |......|.|....::|:..|.::|:..|
  Fly     2 KEANLEDQYASFPEIRRPEVLKFLDWIHAQPHISD-RFSEGEALHFFHACRYSMEVAKQVLDTNL 65

  Fly   100 TIRQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDPYKFTSVQMARVHS 164
            |.|....::|..||...|.|........:||||.....|.:||.   ||.|....::...|.|..
  Fly    66 TARTHLEEFFVNLDCERPEIRRAMRTVSIVPLPGATPEGYRVIL---AKLDDLNTSNYNFADVMK 127

  Fly   165 LVCEALLDD----EDSQVAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQNSTPMRHKETHFVN 225
            |.|  ::.|    ||....|:|.:.|....::|.|:...|..::..:..:|.:..:|....||:|
  Fly   128 LYC--MVFDFWMYEDGIQPGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFIN 190

  Fly   226 IPHYANRIIELGVSMLSDKLKKRIIVHKNVDILKTKIDPAILPKEYGGTVPIADMIAQ-FKQKLQ 289
            |..:.::|:.|....:..:|...:.:|.::......:...:|||||||.:..|::..: :.:||.
  Fly   191 IVPFMDKILALMTPFMKKELTTVLHMHSDLKEFYKFVPQEMLPKEYGGQLEEANVAKEIYYKKLL 255

  Fly   290 QRRAAILALDDMQIEVTKDAANFAGNDIGDIDAGVVGSFRKLEVD 334
            ..|..::..:... :|.:........:..|: .|:.|:|:||::|
  Fly   256 DNRKEMIEFETRH-QVNEKLRPGKAKNASDL-FGIEGNFKKLDID 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 12/45 (27%)
CRAL_TRIO 126..274 CDD:279044 39/151 (26%)
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 39/149 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.