DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and pinta

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster


Alignment Length:282 Identity:68/282 - (24%)
Similarity:120/282 - (42%) Gaps:35/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AKEELHEDENIRRQALAQFR---EWIEKHPHIRKCRTDTVF--LLRFLRTKKFSVPSACEMLERY 98
            :|.::...:....:.|||.:   :|:..:|.|..|.|   |  |..||||.||.|..|.:.|:.:
  Fly     8 SKRQVATTDGDPERVLAQVQDLSDWLVANPQINGCNT---FENLHFFLRTSKFDVERAKKKLKTF 69

  Fly    99 LTIRQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDPYKFTSVQMARVH 163
            ..:|....:||...|...|.|.::.:.|..:|:.. |:..|.|:....|..||...:...:.:..
  Fly    70 YQMRAERTEWFDNRDPQLPEIQDLLKLGVFLPIGP-DAEQRMVVVIRTAAHDPKLHSQNNVFKTS 133

  Fly   164 SLVCEALLD-DEDSQVAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQNST------PMRHKET 221
            .::.:.||. |.::...|.|.|.|..|:.:|..       |:...|.|:.|.      |.:.|..
  Fly   134 KMILDLLLKLDPETCARGMVAILDMQGVQLGHA-------LQMNPKLIKRSVESWTAYPCQPKLL 191

  Fly   222 HFVNIPHYANRIIELGVSMLSDKLKKRIIVHKNVDILKTKIDPAILPKEYGGT-VPIADMIAQFK 285
            .|.|.|.:.|..:......::.|::.|:.|.:.    .|.:....||||.||. :...::..::|
  Fly   192 EFTNAPRHVNFFLNTFRIFMTPKIRSRLFVRRE----GTSVSCDQLPKELGGQGLSYMELSVKWK 252

  Fly   286 QKLQQRRAAILALDDMQIEVTK 307
            |.:::..       |..:|..|
  Fly   253 QLVEENA-------DFYVEQDK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 19/50 (38%)
CRAL_TRIO 126..274 CDD:279044 36/154 (23%)
pintaNP_001287466.1 SEC14 87..240 CDD:238099 38/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.