DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and CG33966

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster


Alignment Length:327 Identity:98/327 - (29%)
Similarity:169/327 - (51%) Gaps:36/327 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PYVCGLSPAMKLVAKEELHEDENIRRQALAQFREWIEKHPHIRKCRTDTVFLLRFLRTKKFSVPS 90
            |.:..|||.::..|.|.|:|..|.....:|..|:||::.||: |.|||..||:.|||..|||:..
  Fly     2 PAIRPLSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHL-KARTDDQFLVNFLRGCKFSLER 65

  Fly    91 ACEMLERYLTIRQLFPQWF--KQLDINDPAINEIFENGYLV--PLPQRDSTGRQVIFSVAAKFDP 151
            ....::|:.|:|..:|:::  ..:|: |.|: |||..|.:|  |.|..|:..|..:..:|. :||
  Fly    66 TKSKIDRFYTLRTKYPEFYLGHNVDV-DKAL-EIFRLGTIVILPRPLNDNGPRLALLRMAC-YDP 127

  Fly   152 YKFTSVQMARVHSLVCEALLDDED-SQVAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQNSTP 215
            .|:|..::.|...|:.:.:||::| :.|.|.:.|.|.|.:..|.....|.:..:.:....:.:.|
  Fly   128 SKYTLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALP 192

  Fly   216 MRHKETHFVNIPHYANRIIELGVSMLSDKLKKRIIVH-KNVDILKTKIDPAILPKEYG---GTVP 276
            :|.:..||:|.|:..:.|..:...|:|.|.:.|:.|| ...:.|..:|....||.|||   |::|
  Fly   193 LRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGGENGSIP 257

  Fly   277 IADMIAQFKQKLQQRRAAILALDDMQIEVTKDAANFAGND----IG---DIDA--GVVGSFRKLE 332
              :::.|::|::...|           ...::..|: |.|    :|   |.::  |:.||||:|.
  Fly   258 --ELLQQWEQRILAYR-----------NYWEEEKNY-GTDESLRVGQPVDFESLFGLQGSFRQLN 308

  Fly   333 VD 334
            ||
  Fly   309 VD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 18/45 (40%)
CRAL_TRIO 126..274 CDD:279044 43/154 (28%)
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 18/42 (43%)
SEC14 96..252 CDD:238099 46/156 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.