DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and CG33523

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:240 Identity:55/240 - (22%)
Similarity:89/240 - (37%) Gaps:63/240 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EELHEDENIRRQA----LAQFREWIEKHP-HIRKCRTDTVFLLRFLRTKKFSVPSACEMLERYLT 100
            |||.:..| |:.|    .|.|      || .|.:.|.|.::|.|||......:.::...|.....
  Fly    14 EELRDRFN-RKYASSPPAAPF------HPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSLWETCI 71

  Fly   101 IRQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDPYKFTSVQMARVHSL 165
            :||.    ....||::..:|:.:.....|.:...|..|:.::              |...::||.
  Fly    72 LRQS----TGANDIDESELNQEYLKEGSVFVHNTDVDGKPLL--------------VFRVKMHSK 118

  Fly   166 VCEALLDD-------------EDSQVAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQNSTPMR 217
              ...||:             .:..:.......|.||     .||.|: ||..:.:.:       
  Fly   119 --SKNLDELIRIVVYWVERTQREQHLTQLTIFFDMSG-----TSLASM-DLEFVKRIV------- 168

  Fly   218 HKETHFVNIPHYANRII--ELG-VSMLSDKLKKRIIVHKNVDILK 259
              ||.....|:..|.|:  ||| |...:.|:.|.::..|.|:|||
  Fly   169 --ETFKQFYPNSLNYILVYELGWVLNAAFKVIKAVLPPKAVEILK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 13/50 (26%)
CRAL_TRIO 126..274 CDD:279044 32/150 (21%)
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 32/149 (21%)
Motile_Sperm 293..396 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.