DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and CG32407

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster


Alignment Length:211 Identity:48/211 - (22%)
Similarity:84/211 - (39%) Gaps:38/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 HPHIRKCRTDT-VFLLRFLRTKKFSVPSACEMLERYLTIRQLFPQWFKQLDINDPAINEIFENGY 127
            ||:..|..||: :::.:.|:...|.|......|...|..|:.|..:    ||.:..:|:.|.|..
  Fly    33 HPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGVY----DITEANLNQEFLNDG 93

  Fly   128 LVPLPQRDSTGRQVIFSVAAKFDPYKFTSVQMARVHSLVCEALLDDEDSQVAGYVYINDESG--- 189
            .:.:..:|..|:.::.....|....: ....:.|:.....|.|  ..||.:.......|.:|   
  Fly    94 SIYVHNKDRDGKPLLILTIKKHSKSR-NQEDLLRILVFWIERL--QRDSNLDKITIFMDMTGAGL 155

  Fly   190 --MNMGFVSLWSLTDLRSIVKCIQNSTPMRHKETHFVNIPHYANRIIELGVSMLSD---KLKKRI 249
              ::|||:        :||:...         ||.:..:|:|   |:...:..|.|   ||.|..
  Fly   156 SNLDMGFI--------KSIIGVF---------ETKYPYVPNY---ILVHDLPFLLDAAFKLVKTF 200

  Fly   250 IVHKNVDILK--TKID 263
            :..:.:.|||  ||.|
  Fly   201 LPPEALKILKVTTKKD 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 9/34 (26%)
CRAL_TRIO 126..274 CDD:279044 31/148 (21%)
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 31/148 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.