DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and Sec14l3

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:262 Identity:61/262 - (23%)
Similarity:105/262 - (40%) Gaps:59/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QALAQFREWIE------KHPHIRKCRTDTVFLLRFLRTKKFSVPSACEMLERYLTIRQLFPQWFK 110
            :.||:|||.::      .:|       |..||||:||.:.|.:..:..||.:|:..|       |
Mouse    14 ETLAKFRENVQDVLPALPNP-------DDYFLLRWLRARNFDLQKSEAMLRKYMEFR-------K 64

  Fly   111 QLDIN------DPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDP----YKFTSVQMARVHSL 165
            .:||:      .|.:.:.:..|.|...   |..|..|.:.:....||    :..|...:.:....
Mouse    65 TMDIDHILDWQPPEVIQKYMPGGLCGY---DRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKTKMR 126

  Fly   166 VCEALLDDEDSQ-------VAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQNSTPM---RHKE 220
            .||.:|.:.|.|       :...|.|.|..|  :|....|     :.:|:..|....:   .:.|
Mouse   127 DCERILHECDLQTERLGRKIETIVMIFDCEG--LGLKHFW-----KPLVEVYQEFFGLLEENYPE 184

  Fly   221 THFVNIPHYANRIIELGVSM----LSDKLKKRIIV----HKNVDILKTKIDPAILPKEYGGTVPI 277
            |....:...|.::..:|.::    ||:..:::|:|    .....:||. |.|..||..:|||:..
Mouse   185 TLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGSNSWKEGLLKL-ISPEELPAHFGGTLTD 248

  Fly   278 AD 279
            .|
Mouse   249 PD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 16/51 (31%)
CRAL_TRIO 126..274 CDD:279044 36/169 (21%)
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 16/51 (31%)
SEC14 76..246 CDD:214706 38/180 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.