DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and Clvs2

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001101929.1 Gene:Clvs2 / 361459 RGDID:1306801 Length:236 Species:Rattus norvegicus


Alignment Length:182 Identity:59/182 - (32%)
Similarity:92/182 - (50%) Gaps:0/182 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GLSPAMKLVAKEELHEDENIRRQALAQFREWIEKHPHIRKCRTDTVFLLRFLRTKKFSVPSACEM 94
            ||||.....|:.||:|:.:...|.:.:.|:.:...|.|...|||..|:|||||.:||....|..:
  Rat     7 GLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRL 71

  Fly    95 LERYLTIRQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDPYKFTSVQM 159
            |.:|...||.....||.....||.|.:..::|:...|...|..||:::...||.:|..::|.|.:
  Rat    72 LAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDI 136

  Fly   160 ARVHSLVCEALLDDEDSQVAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQ 211
            .|...|..||:::|.:.||.|:|.|.|.|.......|..:.:.||..::.:|
  Rat   137 LRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQ 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 17/45 (38%)
CRAL_TRIO 126..274 CDD:279044 26/86 (30%)
Clvs2NP_001101929.1 CRAL_TRIO_N 29..75 CDD:215024 17/45 (38%)
SEC14 103..>204 CDD:301714 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4343
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.