DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and Sec14l1

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:350 Identity:79/350 - (22%)
Similarity:132/350 - (37%) Gaps:79/350 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSGPAASSGGDYDYPYVCGLSPAMKLVA---KEELHEDENIRRQALAQFREWIEKHPHIRKCRTD 73
            |||...||.|....|.|.  :|..||.|   |..|.:...::...|.:.|:|::: .|..|...|
  Rat   217 LSGEVLSSPGTVAEPVVG--TPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQE-THKGKIPKD 278

  Fly    74 TVFLLRFLRTKKFSVPSACEMLERYLTIRQLFPQWFKQ------LDINDPAINEIFENGYLVPLP 132
            . .:|||||.:.|::..|.|::.:.||       |.||      ||...|.  ::.::.|.....
  Rat   279 E-HILRFLRARDFNIDKAREIMCQSLT-------WRKQHQVDYILDTWTPP--QVLQDYYAGGWH 333

  Fly   133 QRDSTGRQVIFSVAAKFDPYKFTSVQMARVHSLVCEALLD-------------DEDSQVAG---- 180
            ..|..||.:......:.|       ....|.:|..||||.             :|:::|.|    
  Rat   334 HHDKDGRPLYVLRLGQMD-------TKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPIS 391

  Fly   181 -YVYINDESGMNMGFVSLW--SLTDLRSIVKCIQNSTPMRHKETHFVNIPHYANRIIELGVSMLS 242
             :..:.|..|:||.  .||  .:..|..|::.::.:.|........:..|.....:..|....:.
  Rat   392 SWTCLVDLEGLNMR--HLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFID 454

  Fly   243 DKLKKRIIVHKNVDI-----LKTKIDPAILPK----------EYGGTVPIADMIAQFKQKLQQRR 292
            |..:::.:::...|.     |...||..|:|.          ..||.||          |...|.
  Rat   455 DNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGECMCDVPEGGLVP----------KSLYRT 509

  Fly   293 AAILALDDMQI---EVTKDAANFAG 314
            ...|..:|:::   .:.:.|:.|.|
  Rat   510 PEELENEDLKLWTETIYQSASVFKG 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 14/45 (31%)
CRAL_TRIO 126..274 CDD:279044 33/182 (18%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 14/46 (30%)
CRAL_TRIO 327..491 CDD:279044 32/172 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.