DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and Ku80

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:232 Identity:47/232 - (20%)
Similarity:86/232 - (37%) Gaps:75/232 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RFLRTKKFS-----VPSACEMLERYLT--IRQLFP-----QWFKQLDINDPAINEIFENGYLV-- 129
            :.|:.|.|:     ||...|...:...  :::|||     .|.::|...:.|     |||..|  
  Fly   485 KMLKDKNFADVFWRVPDPLEEKSKRAAAIVKKLFPLRYSR
AWQEKLLAKEQA-----ENGVAVKS 544

  Fly   130 -------PLPQRDSTG--------RQVIFSV-----AAKFDPYKFTSVQMARVHSLVCEALLDDE 174
                   |||. |..|        |:|:.||     |.:.|         ||..:|..       
  Fly   545 EPAEKEIPLPS-DGVGLIDPISDFRRVLASVHTISNATERD---------ARFQALAA------- 592

  Fly   175 DSQVAGYVYINDESGMNMGFVSLWSLTDLRSIVK--CIQNSTPMRHKETHFVNIPHYANRIIELG 237
            |::|. .:.:......|:|     .|.:|.::.:  ||..:|        |:....:|..:.::.
  Fly   593 DTRVV-IITLLQRRKQNIG-----QLGELITLYRQSCIDFNT--------FLEYDKFAEELKKIA 643

  Fly   238 VSMLSDKLKKRIIVHKNVDIL---KTKIDPAILPKEY 271
            ::....:..:.::|.|.:..|   :..:|..:..|.|
  Fly   644 LAKNRSEFWQDVMVDKQLGPLVLGEPTLDDELALKAY 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 6/23 (26%)
CRAL_TRIO 126..274 CDD:279044 33/173 (19%)
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 9/38 (24%)
Ku_PK_bind 562..663 CDD:285938 22/130 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.