DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and CG5973

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:252 Identity:64/252 - (25%)
Similarity:120/252 - (47%) Gaps:9/252 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AKEELHEDENIRRQALAQFREWIEKHPHIRKCRTDTVFLLRFLRTKKFSVPSACEMLERYLTIRQ 103
            |::||.|...::.||:.:.||.|:...:: ....|..:::.|||...:...||.:.|:.:..::.
  Fly    39 AQDELREVPGVKEQAIKELRELIQNEKYL-NLPLDDEYMMMFLRPTHYYPESALKRLKNFYHMKL 102

  Fly   104 LFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGRQ-VIFSVAAKFDPYKFTSVQMARVHSLVC 167
            .:....:  :|....:..:||...|..|||||..||: ::.....|:.|.:...|.:.|...|..
  Fly   103 KYGAACE--NIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTV 165

  Fly   168 EALLDDEDSQVAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQNSTPMRHKETHFVNIPHYANR 232
            ...:.:..||:.|.|.|.|..|:.:..::.::.:....::..||....||.|..|.||..:..|.
  Fly   166 LGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKAVHIVNNSYIFNM 230

  Fly   233 IIELGVSMLSDKLKKRIIVH-KNVDILKTKIDPAILPKEYGGT----VPIADMIAQF 284
            :..:....:.:||:|||..| |:...|.:.|:...||.:|||:    :|...::.:|
  Fly   231 LFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGSATWELPHGKVLGEF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 12/45 (27%)
CRAL_TRIO 126..274 CDD:279044 42/149 (28%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/45 (27%)
SEC14 116..272 CDD:238099 43/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.