DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and retm

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster


Alignment Length:269 Identity:58/269 - (21%)
Similarity:96/269 - (35%) Gaps:64/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LLRFLRTKKFSVPSACEML------ERYLTIRQLFPQWFKQLDINDPA-INEIFENGYLVPLPQR 134
            :||||..:.:.|..|..||      .|...|..|..::.|      || :.|.|..|:    ...
  Fly   247 ILRFLAARDWHVSQAYAMLCDS
LRWRREHRIDALLAEYSK------PAVVVEHFPGGW----HHL 301

  Fly   135 DSTGRQVIFSVAAKFDP---YKFTSVQ-MARVHSLVCEALLD--DEDSQ-----VAGYVYINDES 188
            |..||.|........|.   .|...:. :.|:...:||..:.  :|.::     |..:..:.|..
  Fly   302 DKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLE 366

  Fly   189 GMNMGFVSLW--SLTDLRSIVKCIQNSTPMRHKETHFVNIPHYANRIIELG---VSMLSDKLKKR 248
            |::|.  .||  .:..|.:|::.::.:.|........|..|    |:..:.   ||...|:..:.
  Fly   367 GLSMR--HLWRPGIKALLNIIETVERNYPETMGRVLVVRAP----RVFPIAWTIVSAFIDEHTRS 425

  Fly   249 IIVHKNVDILKTK------IDPAILPKEYGGTVPIADMIAQ--------FKQKLQQRRAAILALD 299
            ..:....|....|      :|..|:|...||  |...||.:        :|..         :|:
  Fly   426 KFLFYGPDCAHMKDGLAQYLDEEIVPDFLGG--PCKTMIHEGGLVPKTLYKMN---------SLE 479

  Fly   300 DMQIEVTKD 308
            |...|||.:
  Fly   480 DHDDEVTAE 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 8/26 (31%)
CRAL_TRIO 126..274 CDD:279044 32/169 (19%)
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 8/20 (40%)
CRAL_TRIO 293..456 CDD:279044 32/172 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.