DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and CG3823

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:302 Identity:74/302 - (24%)
Similarity:140/302 - (46%) Gaps:11/302 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LVAKEELHEDENIRRQALAQFREWIEKHPHIRKCRTDTVFLLRFLRTKKFSVPSACEMLERYLTI 101
            :|...|..||: :....::..::|::..|.:.: ....:.|.|||.|.:..:.:|..:||....:
  Fly     1 MVHLNEKAEDQ-LMTTRISDLQDWLQAQPQLPQ-NISRLLLRRFLHTTRGDLSAAQRLLELNYGL 63

  Fly   102 RQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDPYKFTSVQMARVHSLV 166
            |......|...|..|.:..::.:...|||||.......:::|.....||..||......:|..:|
  Fly    64 RNKHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIKVFFMV 128

  Fly   167 --CEALLDDEDSQVAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQNSTPMRHKETHFVNIPHY 229
              |....::|:....|.:.:.|.:|..:..::..:|..||..:|.:|.:.|:|.||.|.:|.|.|
  Fly   129 ADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPSY 193

  Fly   230 ANRIIELGVSMLSDKLKKRIIVH-KNVDILKTKIDPAILPKEYGGTV-PIADMIAQFKQKLQQRR 292
            .::::.:....:..::.|.|..| .|.|........::||:||||.. .::|:..|:.|.|:::|
  Fly   194 VDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQLLKEQR 258

  Fly   293 AAILALDDMQIEVTKDAANFAGNDIGDIDAGVVGSFRKLEVD 334
            ..::..::.||...|.......:     |:||....|.||:|
  Fly   259 DYLMDTENWQINKIKKNGQRKSS-----DSGVTEGLRSLEID 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 10/45 (22%)
CRAL_TRIO 126..274 CDD:279044 40/150 (27%)
CG3823NP_572313.1 SEC14 90..239 CDD:238099 40/148 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.