DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and CG3091

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster


Alignment Length:299 Identity:74/299 - (24%)
Similarity:123/299 - (41%) Gaps:37/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GDYDYPYVCGLSPAMKLVAKEELHEDENIRRQALAQFREWIEKHPHIRKCRTDTVFLLRFLRTKK 85
            ||.|.......|||.....|             |.....|.|.:|::.: :.:.:.:||||:...
  Fly     6 GDKDSAPETSASPATGWSDK-------------LTDLVAWFEANPNLPE-KIEPIVMLRFLKCTA 56

  Fly    86 FSVPSACEMLERYLTIRQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFD 150
            |.|.....:.|....:|...|..|...::.|....|......|:.||.....|.::||...|..|
  Fly    57 FDVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGNKLIFFRMADLD 121

  Fly   151 PYKFTSVQMARVHSLVCEA-----------------LLDDEDSQVAGYVYINDESGMNMGFVSLW 198
            |....||:..::..::.:|                 :||:.|. ..|.|.|.|..|..:..::..
  Fly   122 PRTRNSVEETKIFVMMSDARFTKPDVERETGSGADYVLDEADI-AEGDVQIVDIGGYTLRHLAYV 185

  Fly   199 SLTDLRSIVKCIQNSTPMRHKETHFVNIPHYANRIIELGVSMLSDKLKKRIIVH-KNVDILKTKI 262
            |:..||..:|.:|.:.|.|.:..|.:|.|.|.:::|.:....|.::::..|..| :.:|.|..::
  Fly   186 SIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEV 250

  Fly   263 DPAILPKEYGGTVPIADMIAQFKQK-LQQRRAAILALDD 300
            ...:||.||||.   |..:|:.|.| :|..|.....|.|
  Fly   251 PRDMLPNEYGGK---AGTVAELKAKGIQSIRDNAAYLSD 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 11/45 (24%)
CRAL_TRIO 126..274 CDD:279044 42/165 (25%)
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 41/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.