DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10657 and SEC14L3

DIOPT Version :9

Sequence 1:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_011528430.1 Gene:SEC14L3 / 266629 HGNCID:18655 Length:412 Species:Homo sapiens


Alignment Length:261 Identity:62/261 - (23%)
Similarity:107/261 - (40%) Gaps:58/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QALAQFREWIE------KHPHIRKCRTDTVFLLRFLRTKKFSVPSACEMLERYLTIRQLFPQWFK 110
            :.||:|||.::      .:|       |..||||:||.:.|.:..:..:|.:|:..|       |
Human    14 ETLAKFRENVQDVLPALPNP-------DDYFLLRWLRARNFDLQKSEALLRKYMEFR-------K 64

  Fly   111 QLDIN------DPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDP----YKFTSVQMARVHSL 165
            .:||:      .|.:.:.:..|.|...   |..|..|.:.:....||    :..|...:.:....
Human    65 TMDIDHILDWQPPEVIQKYMPGGLCGY---DRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKTKMR 126

  Fly   166 VCEALLDDEDSQ-------VAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQNSTPM---RHKE 220
            .||.:|.:.|.|       :...|.|.|..|  :|....|     :.:|:..|....:   .:.|
Human   127 DCERILHECDLQTERLGKKIETIVMIFDCEG--LGLKHFW-----KPLVEVYQEFFGLLEENYPE 184

  Fly   221 THFVNIPHYANRIIELGVSM----LSDKLKKRIIVHKN---VDILKTKIDPAILPKEYGGTVPIA 278
            |....:...|.::..:|.::    ||:..:::|||..|   ..:||. |.|..||.::|||:...
Human   185 TLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKL-ISPEELPAQFGGTLTDP 248

  Fly   279 D 279
            |
Human   249 D 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 15/51 (29%)
CRAL_TRIO 126..274 CDD:279044 38/168 (23%)
SEC14L3XP_011528430.1 CRAL_TRIO_N 13..59 CDD:215024 15/51 (29%)
SEC14 76..245 CDD:214706 40/179 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.